| Status | Status Details | Main knot | Main knot (knot pull) | Project name | Input data | Model lengths | Last status changed | Job submitted | Key | What to compute? | Closure | Number of random closures | Accuracy | Trajectory (Knot Pull) | Search Identical |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FINISHED | 2025-01-27 23:45:30: AF-A0A4R1MXB5-F1 - main chain unknotted ... | 83 (58%) | 80(A)[-8(+), -14(-), -12(-), -2(+), -16(+), -6(-), -4(-), -10(+)](A) | Recomputed from: A0A4R1MXB5-F1-AFv4 |
AF-A0A4R1MXB5-F1.cif |
2025-01-28 00:18:16 | 2025-01-27 23:44:35 | a47facba3efc4e | Full matrix always | close by statistical methods | 100 | Detailed | Yes | Yes: Identity: 70% |
| Main knot |
83 (58%)
|
| Knot fingerprint |
K 83 61 61 41 41 41
|
| Global pLDDT |
90.1
|
| Topological complexity |
Knot with a high (8) number of crossings
|
| pLDDT Knot-core |
Very high (90.1); 95.6% has >70 pLDDT; 0.0% has <50 pLDDT
|
| pLDDT N-end knot-core border |
Very high (91.5); 100.0% has >70 pLDDT; 0.0% has <50 pLDDT
|
| pLDDT C-end knot-core border |
Very high (91.7); 100.0% has >70 pLDDT; 0.0% has <50 pLDDT
|
| C-alpha clashes |
No clashes
|
Knot cutoff: 30 %
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Slipknot tails | Slipknot loops | Main knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
None | 16-450 | 434 | 1-15, 451-457 | 15 | 7 |
|
Knot | |||||
|
89.8 | 36-413 | 377 | 1-35, 414-457 | 35 | 44 | Knot | ||||||
|
89.7 | 92-432 | 340 | 1-91, 433-457 | 91 | 25 | 1-42,447-457 | 43-91,433-446 | Slipknot |
Model Sequence |
MNLNKAKKQLEKGENISESLEIIVDNQKTLYYNYALVNFAFEYIVLGTKIDDYLTNKESEWIILKIKDITERVVLDKNIDESLLKEIDSLRKNISKKLEVLTTYVDELEIYEYIVNRQENNQDFISNEEVFAKEIVSFVFASKDNVTINQKLKEVLEQLPMRLTKAKFFDYIQDSLTLYKGTPEDKLIDLLSILEKIYSPEKNEGYGEEFEDIYALVNKIKSKVSKNMEDQTIAEVKEDFLYVSTVLKENVDRYLDAIKVTNLLYTMMVCFGKNIEPNANAIKIIKEVQEKWHENNEDIIENLINELGQLEGVQEDLNFTIQKNESSIDLAVNDYYAVYKNTLIEKDINNVKTAQSLTSSSFFVDLEESNEPSNVLDDKKIYELVNAFLNQIEIEMKKDDMIIRRAKMSKIIATLPTFFKEAEAIYEYIAFAFNQCRDQREKTASISLIKELMEDYE
|
