| Protein name |
tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] methyltransferase)
|
| Main knot |
31 (86%)
|
| Global pLDDT |
89.04
|
| Species |
Deinococcus sp
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A072NBZ5
|
| PDB structures |
-
|
| Model length |
232
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
91.2 | 101-143 | 43 | 1-100, 144-232 | 100 | 89 |
|
Model Sequence |
MTPERYQKILRVLRRRQPTLTVLMDEVHKPHNLSAIVRTCDAVGVLEAHAVPPKGGQLATFEGHTYAATSGSAHKWVPVRSHPDALGAVRALQGRGFQVLATHLSQRSVDYRDPDYTRPTCVLLGAEKWGVSDEAADAADANIVIPMYGMVQSLNVSVAAATILFEAQRQRLLAGMYDAPQLAPEDLARLAFEWAYPDLAPSYRERGEPYPALDETGQIVGQPPSAGGPAER
|
| Protein name |
tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] methyltransferase)
|
| Main knot |
31 (91%)
|
| Global pLDDT |
92.65
|
| Species |
Deinococcus sp
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
232
|
| ESM generation time |
2023-06-25: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
96.5 | 101-143 | 43 | 1-100, 144-232 | 100 | 89 |
|
Model Sequence |
MTPERYQKILRVLRRRQPTLTVLMDEVHKPHNLSAIVRTCDAVGVLEAHAVPPKGGQLATFEGHTYAATSGSAHKWVPVRSHPDALGAVRALQGRGFQVLATHLSQRSVDYRDPDYTRPTCVLLGAEKWGVSDEAADAADANIVIPMYGMVQSLNVSVAAATILFEAQRQRLLAGMYDAPQLAPEDLARLAFEWAYPDLAPSYRERGEPYPALDETGQIVGQPPSAGGPAER
|