| Protein name |
Alpha-carbonic anhydrase domain-containing protein
|
| Main knot |
31 (71%)
|
| Global pLDDT |
92.6
|
| Species |
Betaproteobacteria bacterium
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A177QY45
|
| PDB structures |
-
|
| Structure in AlphaLasso |
A0A177QY45: LS2++C
|
| Model length |
247
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
98.0 | 55-246 | 192 | 1-54, 247-247 | 54 | 1 |
|
Model Sequence |
MCSITLACAATFLPGASHAQEGHHEWDYGTEHGPKHWGALKGEFASCATGKTQSPIDIHNAVPSKLAPIRFDYHPTPLHIIDNGHTIQINYGSGSSISVGKQRYELVQFHFHRPSEEKIDGKGYPMVVHLVHKNSAGALAVVAVLLKQGSSNRLVQTLWANLPAEKEKEKAADKVTIDAAQLLPSDHAYYTFSGSLTTPPCTEGVTWFVLANPVDVSAAQVSRFGKVYNGNARPVQPLNGRVVKMSQ
|
| Protein name |
Alpha-carbonic anhydrase domain-containing protein
|
| Main knot |
31 (71%)
|
| Global pLDDT |
94.11
|
| Species |
Betaproteobacteria bacterium
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Structure in AlphaLasso |
A0A177QY45: LS2++C
|
| Model length |
247
|
| ESM generation time |
2023-06-24: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
84.1 | 55-245 | 191 | 1-54, 246-247 | 54 | 2 |
|
Model Sequence |
MCSITLACAATFLPGASHAQEGHHEWDYGTEHGPKHWGALKGEFASCATGKTQSPIDIHNAVPSKLAPIRFDYHPTPLHIIDNGHTIQINYGSGSSISVGKQRYELVQFHFHRPSEEKIDGKGYPMVVHLVHKNSAGALAVVAVLLKQGSSNRLVQTLWANLPAEKEKEKAADKVTIDAAQLLPSDHAYYTFSGSLTTPPCTEGVTWFVLANPVDVSAAQVSRFGKVYNGNARPVQPLNGRVVKMSQ
|