| Protein name |
Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase)
|
| Main knot |
31 (80%)
|
| Global pLDDT |
74.6
|
| Species |
Parafannyhessea umbonata
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A1G6M1Z3
|
| PDB structures |
-
|
| Model length |
227
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
85.6 | 101-143 | 43 | 1-100, 144-227 | 100 | 84 |
|
Model Sequence |
MFNIVLYAPEIPANTGNIGRTCVLTGSRLHLVEPLGFSLDSRMLRRAGLGYWPNLDVTRYAGWDEFLRRNGLAGGDDGARGQGDGAATAGNAPAGTPGLHLLTKKARRTYAESTYRDGDFLVFGSESTGIPEQVLAAHPASCERIPMLPDARSLSNRDAWAAHEASLGDAAASAGVGASPLARQDICGNFVNVDDWRISALNLSNAVAVVLYEALRQTGFAGMGAGA
|
| Protein name |
Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase)
|
| Main knot |
31 (84%)
|
| Global pLDDT |
80.94
|
| Species |
Parafannyhessea umbonata
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
227
|
| ESM generation time |
2023-06-22: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
96.4 | 101-143 | 43 | 1-100, 144-227 | 100 | 84 |
|
Model Sequence |
MFNIVLYAPEIPANTGNIGRTCVLTGSRLHLVEPLGFSLDSRMLRRAGLGYWPNLDVTRYAGWDEFLRRNGLAGGDDGARGQGDGAATAGNAPAGTPGLHLLTKKARRTYAESTYRDGDFLVFGSESTGIPEQVLAAHPASCERIPMLPDARSLSNRDAWAAHEASLGDAAASAGVGASPLARQDICGNFVNVDDWRISALNLSNAVAVVLYEALRQTGFAGMGAGA
|