| Protein name |
YLAT2 protein
|
| Main knot |
41 (63%)
|
| Global pLDDT |
77.22
|
| Species |
Scaled quail
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A226MD67
|
| PDB structures |
-
|
| Model length |
322
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
88.8 | 75-304 | 230 | 1-74, 305-322 | 74 | 18 |
|
Model Sequence |
CSLESWRIHSPSTMGERTDCAKSHTSLAEYSPVSKSDKTDPNDHSEIQDGNQNTMQLKKEISLLNGISLIVGNMIGSGIFVSPKGVLIYSKSYGLSLVIWAIGGIFSVFGALCYAELGTTITKSGASYAYILESFGSFIAFIRLWTSLLIVEPTSQAVIAITFANYIVQPFFPSCDPPYIACRLIAAACECLLTFVNCAYVKWGTRVQDVFTYAKVAALIAIIVTGIVKICQGYSSHFQNSFEGSSVDIGDISLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAVSMPIVTVIYIMTNVAYYTVLDVQAVLSSDAVAV
|
| Protein name |
YLAT2 protein
|
| Main knot |
41 (57%)
|
| Global pLDDT |
89.59
|
| Species |
Scaled quail
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
322
|
| ESM generation time |
2023-06-25: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
71.4 | 75-304 | 230 | 1-74, 305-322 | 74 | 18 |
|
Model Sequence |
CSLESWRIHSPSTMGERTDCAKSHTSLAEYSPVSKSDKTDPNDHSEIQDGNQNTMQLKKEISLLNGISLIVGNMIGSGIFVSPKGVLIYSKSYGLSLVIWAIGGIFSVFGALCYAELGTTITKSGASYAYILESFGSFIAFIRLWTSLLIVEPTSQAVIAITFANYIVQPFFPSCDPPYIACRLIAAACECLLTFVNCAYVKWGTRVQDVFTYAKVAALIAIIVTGIVKICQGYSSHFQNSFEGSSVDIGDISLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAVSMPIVTVIYIMTNVAYYTVLDVQAVLSSDAVAV
|