| Protein name |
Alpha-carbonic anhydrase domain-containing protein
|
| Main knot |
31 (60%)
|
| Global pLDDT |
92.41
|
| Species |
Helicobacter sp
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A268TJQ9
|
| PDB structures |
-
|
| Structure in AlphaLasso |
A0A268TJQ9: L+1C
|
| Model length |
240
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
98.0 | 50-239 | 190 | 1-49, 240-240 | 49 | 1 |
|
Model Sequence |
MNKFKLILGIGLSLSVLLAADHSWSYSGKHGPEHWGDDFITCKVGNTQSPINIIKSQVSEGGKKVEIDYKNANATIENNGHTVQINYPKGNYATIGDDKYELIQFHFHTPGENAIDGKVAPLEAHFVGKDSKGKYAVIAVLFEEGKINGTLQQVIHTMPTKVNVTHHVHNVKINGLLPKDDDAYQFSGSLTTPPCTQDIEWVVLKEPVSAARSQIKALSKVMGHNARPLQKLNNREIKAN
|
| Protein name |
Alpha-carbonic anhydrase domain-containing protein
|
| Main knot |
31 (59%)
|
| Global pLDDT |
94.0
|
| Species |
Helicobacter sp
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Structure in AlphaLasso |
A0A268TJQ9: L+1C
|
| Model length |
240
|
| ESM generation time |
2023-06-26: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
84.3 | 50-239 | 190 | 1-49, 240-240 | 49 | 1 |
|
Model Sequence |
MNKFKLILGIGLSLSVLLAADHSWSYSGKHGPEHWGDDFITCKVGNTQSPINIIKSQVSEGGKKVEIDYKNANATIENNGHTVQINYPKGNYATIGDDKYELIQFHFHTPGENAIDGKVAPLEAHFVGKDSKGKYAVIAVLFEEGKINGTLQQVIHTMPTKVNVTHHVHNVKINGLLPKDDDAYQFSGSLTTPPCTQDIEWVVLKEPVSAARSQIKALSKVMGHNARPLQKLNNREIKAN
|