| Protein name |
Solute carrier family 7 member 7
|
| Main knot |
41 (81%)
|
| Global pLDDT |
82.89
|
| Species |
Northern white-cheeked gibbon
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A2I3HKE2
|
| PDB structures |
-
|
| Model length |
310
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
89.8 | 51-280 | 230 | 1-50, 281-310 | 50 | 30 |
|
Model Sequence |
MVDSTEYEVASQPEVETSPLGDGASPGLEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFVNCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVAFLCGLKRRPSP
|
| Protein name |
Solute carrier family 7 member 7
|
| Main knot |
41 (75%)
|
| Global pLDDT |
92.63
|
| Species |
Northern white-cheeked gibbon
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
310
|
| ESM generation time |
2023-06-25: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
85.1 | 51-280 | 230 | 1-50, 281-310 | 50 | 30 |
|
Model Sequence |
MVDSTEYEVASQPEVETSPLGDGASPGLEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFVNCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVAFLCGLKRRPSP
|