| Protein name |
Thioredoxin
|
| Main knot |
71 (50%)
|
| Global pLDDT |
83.7
|
| Species |
Metamycoplasma cloacale
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A2Z4LME4
|
| PDB structures |
-
|
| Model length |
87
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
84.2 | 17-86 | 70 | 1-16, 87-87 | 16 | 1 |
|
Model Sequence |
MSKMTKKDLEKYKGKKIIFKRVSSGEDIKVKISSWGADYKFKTLYEKPSSWFSTFPTIKAKIVTSGEDVKLEQTDSSWFNDFEIYFE
|
| Protein name |
Thioredoxin
|
| Main knot |
01 (89%)
|
| Species |
Metamycoplasma cloacale
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
87
|
| ESM generation time |
2023-06-26: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
Model Sequence |
MSKMTKKDLEKYKGKKIIFKRVSSGEDIKVKISSWGADYKFKTLYEKPSSWFSTFPTIKAKIVTSGEDVKLEQTDSSWFNDFEIYFE
|
| Domain |
Bacteria
|
| Family |
Metamycoplasmataceae
|
| Species (Full Name) |
Metamycoplasma cloacale
|
| Gene |
DK849_02570
|
| PDB structures (whole Protein) |
-
|