| Protein name |
Integral membrane protein
|
| Main knot |
31 (46%)
|
| Global pLDDT |
88.92
|
| Species |
endosymbiont of
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A370DSJ4
|
| PDB structures |
-
|
| Model length |
332
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
88.2 | 18-240 | 223 | 1-17, 241-332 | 17 | 92 |
|
Model Sequence |
MIELLNNQLTYRFPEVHQKAGCSIDFQRTLRIPDDNREYPLPPGLGRFPVEHVDDFANKLPDTWRTHGGVFIPMYQSEALWINFSGDYPCAIKIAAGKINAVSGEPWSNGLSADPQDYAVIPEQPWLDGFNVSEDFIRQFVAMPLGEGFTAEEQITGTAEHGGLQIIVYPMKHDVYVEHFERTVQADMDYLDMPMFSRTVCESAAPDMGLAPGGLMRQEIYEDEYGIDAWDQDNGFRCFVHLANSAQYLAITGHKPPHTPPTANDYTSAGLPWFDYYSDAKALSGSDTLGKLTSVAAKVIEKGKGLLPDNEPVHPKTVKIISKGNVVRDGEF
|
| Protein name |
Integral membrane protein
|
| Main knot |
52 (54%)
|
| Global pLDDT |
70.05
|
| Species |
endosymbiont of
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
332
|
| ESM generation time |
2023-06-24: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
85.2 | 26-258 | 233 | 1-25, 259-332 | 25 | 74 |
|
Model Sequence |
MIELLNNQLTYRFPEVHQKAGCSIDFQRTLRIPDDNREYPLPPGLGRFPVEHVDDFANKLPDTWRTHGGVFIPMYQSEALWINFSGDYPCAIKIAAGKINAVSGEPWSNGLSADPQDYAVIPEQPWLDGFNVSEDFIRQFVAMPLGEGFTAEEQITGTAEHGGLQIIVYPMKHDVYVEHFERTVQADMDYLDMPMFSRTVCESAAPDMGLAPGGLMRQEIYEDEYGIDAWDQDNGFRCFVHLANSAQYLAITGHKPPHTPPTANDYTSAGLPWFDYYSDAKALSGSDTLGKLTSVAAKVIEKGKGLLPDNEPVHPKTVKIISKGNVVRDGEF
|
| Domain |
Bacteria
|
| Family |
sulfur-oxidizing symbionts
|
| Species (Full Name) |
endosymbiont of Escarpia spicata
|
| Gene |
DIZ78_03790
|
| PDB structures (whole Protein) |
-
|