| Protein name |
Secreted protein
|
| Main knot |
51 (83%)
|
| Global pLDDT |
88.14
|
| Species |
Crocinitomicaceae bacterium
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A424QLT2
|
| PDB structures |
-
|
| Model length |
115
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
95.5 | 26-95 | 70 | 1-25, 96-115 | 25 | 20 |
|
Model Sequence |
MRPLILPLLALVSLTFSAESTSAQKIFSVDYESRADVKVFVVDYESQADLLVYKEDYESRAEGNEGHWFFVKYESRADKKIYFVDYASRADLKIFFVDYESRAGWKNTSKQHLLY
|
| Protein name |
Secreted protein
|
| Main knot |
51 (82%)
|
| Global pLDDT |
78.47
|
| Species |
Crocinitomicaceae bacterium
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
115
|
| ESM generation time |
2023-06-27: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
50.9 | 26-95 | 70 | 1-25, 96-115 | 25 | 20 |
|
Model Sequence |
MRPLILPLLALVSLTFSAESTSAQKIFSVDYESRADVKVFVVDYESQADLLVYKEDYESRAEGNEGHWFFVKYESRADKKIYFVDYASRADLKIFFVDYESRAGWKNTSKQHLLY
|