| Protein name |
Si:dkeyp-120h9.1
|
| Main knot |
41 (81%)
|
| Global pLDDT |
83.2
|
| Species |
Barramundi
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A4W6DWB5
|
| PDB structures |
-
|
| Model length |
293
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
88.7 | 34-262 | 229 | 1-33, 263-293 | 33 | 31 |
|
Model Sequence |
MVAEVDSASQGSGVRLKQEISLLHGVCLIVGNMIGSGIFVSPKGVLMYTGSFGLSLVVWAIGGIFSVFGALCYAELGTTIRKSGASYAYILEAFGGFLAFIRLWTSLLIVEPACQAVIALTFSNYLVQPFYPTCSAPYDAVRLIAAVIICLLTFVNCMKVKWGAILQVISTVAKVLALIVIIITGLVKLAQGKITFENSFRGSKLNPGDMALALYSALYSYSGWDTLNFITEEIKNPERNLPLSIAISMPIVTVIYILTNIAYYVVMDADKVLSSEAVAVYSLLVICDCRSRS
|
| Protein name |
Si:dkeyp-120h9.1
|
| Main knot |
41 (69%)
|
| Global pLDDT |
91.87
|
| Species |
Barramundi
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
293
|
| ESM generation time |
2023-06-23: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
88.6 | 34-262 | 229 | 1-33, 263-293 | 33 | 31 |
|
Model Sequence |
MVAEVDSASQGSGVRLKQEISLLHGVCLIVGNMIGSGIFVSPKGVLMYTGSFGLSLVVWAIGGIFSVFGALCYAELGTTIRKSGASYAYILEAFGGFLAFIRLWTSLLIVEPACQAVIALTFSNYLVQPFYPTCSAPYDAVRLIAAVIICLLTFVNCMKVKWGAILQVISTVAKVLALIVIIITGLVKLAQGKITFENSFRGSKLNPGDMALALYSALYSYSGWDTLNFITEEIKNPERNLPLSIAISMPIVTVIYILTNIAYYVVMDADKVLSSEAVAVYSLLVICDCRSRS
|