| Protein name |
Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)
|
| Main knot |
52 (51%)
|
| Global pLDDT |
82.99
|
| Species |
Pig
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A4X1UWB5
|
| PDB structures |
-
|
| Model length |
239
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
87.8 | 7-214 | 208 | 1-6, 215-239 | 6 | 25 |
|
Model Sequence |
MQLKPMEINPEMLNKVLTRLGVAGHWRFADVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDSLLQVIFGILSLTPPRSAENSLSVSKARSASPPWRSARRPNAQCALRF
|
| Protein name |
Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)
|
| Main knot |
52 (36%)
|
| Global pLDDT |
79.32
|
| Species |
Pig
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
239
|
| ESM generation time |
2023-06-23: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
81.1 | 7-238 | 232 | 1-6, 239-239 | 6 | 1 |
|
Model Sequence |
MQLKPMEINPEMLNKVLTRLGVAGHWRFADVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDSLLQVIFGILSLTPPRSAENSLSVSKARSASPPWRSARRPNAQCALRF
|