A0A7K9K3Q8F1

YLAT2 protein
AF4
Categories voted by users:
Information
Protein name
YLAT2 protein
Main knot
41 (66%)
Global pLDDT
82.15
Species
Dicaeum eximium
UniProt
Structure Prediction Model
AlphaFold v4:  A0A7K9K3Q8
PDB structures
-
Model length
306
AlphaFold deposition date
2022-06-01
AlphaKnot deposition date
2023-01-27
Help
Knot types & Model sequence
Knot pLDDT Knot core range Knot core length Knot tails range N-end length C-end length Main Knot
90.7 59-288 230 1-58, 289-306 58 18
Model Sequence
MGERTDHTKSQNSLAEYSPVNKPERTHPSGTQDGDQNTLQLKKEISLLNGISLIVGNMIGSGIFVSPKGVLIHSKSYGLSLIIWAIGGIFSVFGALCYAELGTTITKSGASYAYILESFGSFIAFIRLWTSLLIVEPTSQAIIAITFANYIVQPFFPSCDPPYVACRLIAAACECLLTFINCAYVKWGTRVQDVFTYAKVIALIAIIIAGLTQIFQGHTSHFKNSFGGSSYDIGDISLALYSALFSYSGWDTLNYVTEEIKNPERNLPLAIAVSMPIVTIIYIMTNVAYYTVLDANAVVSSDAVAV
Comments
ESM1
Categories voted by users:
Information
Protein name
YLAT2 protein
Main knot
41 (64%)
Global pLDDT
92.23
Species
Dicaeum eximium
UniProt
Structure Prediction Model
PDB structures
-
Model length
306
ESM generation time
AlphaKnot deposition date
2023-06-28
Help
Knot types & Model sequence
Knot pLDDT Knot core range Knot core length Knot tails range N-end length C-end length Main Knot
80.1 59-288 230 1-58, 289-306 58 18
Model Sequence
MGERTDHTKSQNSLAEYSPVNKPERTHPSGTQDGDQNTLQLKKEISLLNGISLIVGNMIGSGIFVSPKGVLIHSKSYGLSLIIWAIGGIFSVFGALCYAELGTTITKSGASYAYILESFGSFIAFIRLWTSLLIVEPTSQAIIAITFANYIVQPFFPSCDPPYVACRLIAAACECLLTFINCAYVKWGTRVQDVFTYAKVIALIAIIIAGLTQIFQGHTSHFKNSFGGSSYDIGDISLALYSALFSYSGWDTLNYVTEEIKNPERNLPLAIAVSMPIVTIIYIMTNVAYYTVLDANAVVSSDAVAV
Comments
Domain Eukaryota
Family Dicaeidae
Species (Full Name) Dicaeum eximium
Gene Slc7a6_0 DICEXI_R14395
PFAM codes  PF13520
InterPro codes  IPR002293
PDB structures (whole Protein) -