| Protein name |
YLAT2 protein
|
| Main knot |
41 (66%)
|
| Global pLDDT |
82.15
|
| Species |
Dicaeum eximium
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A7K9K3Q8
|
| PDB structures |
-
|
| Model length |
306
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
90.7 | 59-288 | 230 | 1-58, 289-306 | 58 | 18 |
|
Model Sequence |
MGERTDHTKSQNSLAEYSPVNKPERTHPSGTQDGDQNTLQLKKEISLLNGISLIVGNMIGSGIFVSPKGVLIHSKSYGLSLIIWAIGGIFSVFGALCYAELGTTITKSGASYAYILESFGSFIAFIRLWTSLLIVEPTSQAIIAITFANYIVQPFFPSCDPPYVACRLIAAACECLLTFINCAYVKWGTRVQDVFTYAKVIALIAIIIAGLTQIFQGHTSHFKNSFGGSSYDIGDISLALYSALFSYSGWDTLNYVTEEIKNPERNLPLAIAVSMPIVTIIYIMTNVAYYTVLDANAVVSSDAVAV
|
| Protein name |
YLAT2 protein
|
| Main knot |
41 (64%)
|
| Global pLDDT |
92.23
|
| Species |
Dicaeum eximium
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
306
|
| ESM generation time |
2023-06-23: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
80.1 | 59-288 | 230 | 1-58, 289-306 | 58 | 18 |
|
Model Sequence |
MGERTDHTKSQNSLAEYSPVNKPERTHPSGTQDGDQNTLQLKKEISLLNGISLIVGNMIGSGIFVSPKGVLIHSKSYGLSLIIWAIGGIFSVFGALCYAELGTTITKSGASYAYILESFGSFIAFIRLWTSLLIVEPTSQAIIAITFANYIVQPFFPSCDPPYVACRLIAAACECLLTFINCAYVKWGTRVQDVFTYAKVIALIAIIIAGLTQIFQGHTSHFKNSFGGSSYDIGDISLALYSALFSYSGWDTLNYVTEEIKNPERNLPLAIAVSMPIVTIIYIMTNVAYYTVLDANAVVSSDAVAV
|