| Protein name |
Solute carrier family 7 member 7
|
| Main knot |
41 (75%)
|
| Global pLDDT |
83.45
|
| Species |
zig-zag eel
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A7N9APK8
|
| PDB structures |
-
|
| Model length |
287
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
88.4 | 35-263 | 229 | 1-34, 264-287 | 34 | 24 |
|
Model Sequence |
YFNSTEFPEGSEESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIHSASYGLSLVVWTIGGIFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYLANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIGQGAQNFEGLFYGSSQDPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTMIYILTNVAYYTILPINAILDSDAVAVVSVCHP
|
| Protein name |
Solute carrier family 7 member 7
|
| Main knot |
41 (70%)
|
| Global pLDDT |
92.23
|
| Species |
zig-zag eel
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Model length |
287
|
| ESM generation time |
2023-06-24: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
87.4 | 35-263 | 229 | 1-34, 264-287 | 34 | 24 |
|
Model Sequence |
YFNSTEFPEGSEESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIHSASYGLSLVVWTIGGIFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYLANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIGQGAQNFEGLFYGSSQDPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTMIYILTNVAYYTILPINAILDSDAVAVVSVCHP
|