| Protein name |
Carbonic anhydrase (EC 4.2.1.1)
|
| Main knot |
31 (43%)
|
| Global pLDDT |
97.72
|
| Species |
Masked booby
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
A0A850ZTD4
|
| PDB structures |
-
|
| Structure in AlphaLasso |
A0A850ZTD4: L0
|
| Model length |
248
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
97.9 | 18-247 | 230 | 1-17, 248-248 | 17 | 1 |
|
Model Sequence |
GPAHWKEVFPVANGDRQSPIDIKTEETKYDPSLRPLNPNYDPASAKIILNNGHSTSVEFDDTVNKSVLTGGPLSGTYRLRQIHFHWGSNDEAGSEHAVDGMKYAAELHVVHWNSEKYSSFVEAARQSDGLAVMAVFLKIGECNPQLKKITDRLDTIRIKGKRALFTNFNPSCLLPKSLDYWTYFGSLTVPPLLESVIWIVLREPISVCSEQLAKFRSLLSTAEDEVASCLLRNYRPPQPLKGREVRRN
|
| Protein name |
Carbonic anhydrase (EC 4.2.1.1)
|
| Main knot |
31 (41%)
|
| Global pLDDT |
90.33
|
| Species |
Masked booby
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures |
-
|
| Structure in AlphaLasso |
A0A850ZTD4: L0
|
| Model length |
248
|
| ESM generation time |
2023-06-25: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
87.0 | 18-247 | 230 | 1-17, 248-248 | 17 | 1 |
|
Model Sequence |
GPAHWKEVFPVANGDRQSPIDIKTEETKYDPSLRPLNPNYDPASAKIILNNGHSTSVEFDDTVNKSVLTGGPLSGTYRLRQIHFHWGSNDEAGSEHAVDGMKYAAELHVVHWNSEKYSSFVEAARQSDGLAVMAVFLKIGECNPQLKKITDRLDTIRIKGKRALFTNFNPSCLLPKSLDYWTYFGSLTVPPLLESVIWIVLREPISVCSEQLAKFRSLLSTAEDEVASCLLRNYRPPQPLKGREVRRN
|