P73136 | AlphaKnot 2.0

Categories voted by users:

Information

Protein name	Uncharacterized protein slr1025
Main knot	5₁ (90%)
Global pLDDT	87.83
Species	Synechocystis sp.
UniProt	P73136
Structure Prediction Model	AlphaFold v6: P73136
PDB structures	-
Structure in AlphaLasso	P73136: LS_2++C
Model length	112
AlphaFold deposition date	2026-06-01
AlphaKnot deposition date	2026-07-09

Help

Knot types & Model sequence

					Knot pLDDT	Knot core range	Knot core length	Knot tails range	N-end length	C-end length	Main Knot
					98.2	46-101	56	1-45, 102-112	45	11		Knot
					98.23	58-90	33	1-57, 91-112	57	22		Knot

MKNKLGIILVCNCLFSLFINRGVGAEETINIGDCSFNGHPLYGKIQLVGSFPDLTVQVVSSFPDLKVQLVESFPNQCGQWQIVTSFPDTKVQIVESFPDVKIQYVDSFPGLP

Comments

Categories voted by users:

Information

Protein name	Uncharacterized protein slr1025
Main knot	5₁ (91%)
Global pLDDT	88.2
Species	Synechocystis sp.
UniProt	P73136
Structure Prediction Model	AlphaFold v4: P73136
PDB structures	-
Structure in AlphaLasso	P73136: LS_2++C
Model length	112
AlphaFold deposition date	2022-06-01
AlphaKnot deposition date	2023-01-27

Help

Knot types & Model sequence

					Knot pLDDT	Knot core range	Knot core length	Knot tails range	N-end length	C-end length	Main Knot
					98.2	45-103	59	1-44, 104-112	44	9

MKNKLGIILVCNCLFSLFINRGVGAEETINIGDCSFNGHPLYGKIQLVGSFPDLTVQVVSSFPDLKVQLVESFPNQCGQWQIVTSFPDTKVQIVESFPDVKIQYVDSFPGLP

Knot Pull simplified model computed using the Web Server in job: 404cf2e070346a

Comments

Categories voted by users:

Information

Protein name	Uncharacterized protein slr1025
Main knot	7₂ (91%)
Global pLDDT	50.12
Species	Synechocystis sp.
UniProt	P73136
Structure Prediction Model	ESM v1: esmfold_v1 - nov. 2022
PDB structures	-
Structure in AlphaLasso	P73136: LS_2++C
Model length	112
ESM generation time	2023-06-24: download the generated 3D model
AlphaKnot deposition date	2023-06-28

Help

Knot types & Model sequence

					Knot pLDDT	Knot core range	Knot core length	Knot tails range	N-end length	C-end length	Main Knot
					33.8	42-102	61	1-41, 103-112	41	10

MKNKLGIILVCNCLFSLFINRGVGAEETINIGDCSFNGHPLYGKIQLVGSFPDLTVQVVSSFPDLKVQLVESFPNQCGQWQIVTSFPDTKVQIVESFPDVKIQYVDSFPGLP

Comments

Domain	Bacteria
Family	Merismopediaceae
Species (Full Name)	Synechocystis sp. (strain PCC 6803 / Kazusa)
Gene	slr1025
PDB structures (whole Protein)	-

P73136F1