| Protein name |
PHD finger-like domain-containing protein 5A
|
| Main knot |
31 (81%)
|
| Global pLDDT |
88.79
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
 Q7RTV0
|
| PDB structures | |
| Structures in KnotProt |
 5IFE D, K -3.1: 1-110 5O9Z y, K -3.1: 1-110 5SYB A/B, K -3.1: 1-110 5Z56 6, K -3.1: 1-110 5Z57 6, K -3.1: 1-110 5ZYA D, K -3.1: 7-91 6AH0 6, -3.1: 1-110 6AHD 6, -3.1: 1-110 6EN4 D, S -3.1: 1-98 6FF4 y, S -3.1: 1-110 6QX9 BP, K -3.1: 1-104 6Y50 y, -3.1: 1-110 6Y5Q y, -3.1: 1-110 7ABG y, -3.1: 1-110 7ABH y, -3.1: 1-110 7ABI y, -3.1: 1-110 7DVQ 6, -3.1: 1-110
|
| Model length |
110
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
 |
93.4 | 21-70 | 50 | 1-20, 71-110 | 20 | 40 |
|
Model Sequence |
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
|
| Protein name |
PHD finger-like domain-containing protein 5A
|
| Main knot |
31 (75%)
|
| Knot fingerprint |
K 31
|
| Global pLDDT |
89.2
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v1:
Q7RTV0
|
| PDB structures | |
| Structures in KnotProt |
5IFE D, K -3.1: 1-110 5O9Z y, K -3.1: 1-110 5SYB A/B, K -3.1: 1-110 5Z56 6, K -3.1: 1-110 5Z57 6, K -3.1: 1-110 5ZYA D, K -3.1: 7-91 6AH0 6, -3.1: 1-110 6AHD 6, -3.1: 1-110 6EN4 D, S -3.1: 1-98 6FF4 y, S -3.1: 1-110 6QX9 BP, K -3.1: 1-104 6Y50 y, -3.1: 1-110 6Y5Q y, -3.1: 1-110 7ABG y, -3.1: 1-110 7ABH y, -3.1: 1-110 7ABI y, -3.1: 1-110 7DVQ 6, -3.1: 1-110
|
| Model length |
110
|
| AlphaFold deposition date |
2021-07-01
|
| AlphaKnot deposition date |
2021-12-18
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
93.6 | 21-68 | 48 | 1-20, 69-110 | 20 | 42 |
|
Model Sequence |
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
|
| Protein name |
PHD finger-like domain-containing protein 5A
|
| Main knot |
01 (92%)
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures | |
| Structures in KnotProt |
5IFE D, K -3.1: 1-110 5O9Z y, K -3.1: 1-110 5SYB A/B, K -3.1: 1-110 5Z56 6, K -3.1: 1-110 5Z57 6, K -3.1: 1-110 5ZYA D, K -3.1: 7-91 6AH0 6, -3.1: 1-110 6AHD 6, -3.1: 1-110 6EN4 D, S -3.1: 1-98 6FF4 y, S -3.1: 1-110 6QX9 BP, K -3.1: 1-104 6Y50 y, -3.1: 1-110 6Y5Q y, -3.1: 1-110 7ABG y, -3.1: 1-110 7ABH y, -3.1: 1-110 7ABI y, -3.1: 1-110 7DVQ 6, -3.1: 1-110
|
| Model length |
110
|
| ESM generation time |
2023-06-24: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
Model Sequence |
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
|
| Domain |
Eukaryota
|
| Family |
Hominidae
|
| Species (Full Name) |
Homo sapiens
|
| PFAM codes |
PF03660
|
| InterPro codes |
 IPR005345
|
| PDB structures (whole Protein) |
 5IFE D: 1-110 5O9Z y: 1-110 5SYB A/B: 1-110 5Z56 6: 1-110 5Z57 6: 1-110 5Z58 6: 1-110 5ZYA D: 7-91 6AH0 6: 1-110 6AHD 6: 1-110 6EN4 D: 1-98 6FF4 y: 1-110 6FF7 y: 1-110 6QX9 BP: 1-104 6Y50 y: 1-110 6Y5Q y: 1-110 7ABG y: 1-110 7ABH y: 1-110 7ABI y: 1-110 7DVQ 6: 1-110 7B0I D: 1-98 7B91 D: 1-98 7B92 D: 1-98 7B9C D: 1-98 7EVN D: 1-110 7EVO 6: 1-110 7OMF D: 1-98 7ONB D: 1-110 7OPI D: 1-98 7Q3L G: 1-110 7Q4O G: 1-110 7Q4P G: 1-110
|
#similar chains with experimentally solved models (PDB) in the AlphaKnot 2.0 database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains with experimentally solved models not found in AlphaKnot 2.0 database but found in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
Q7RTV0