Q7RTV0 | AlphaKnot 2.0

AF4

Categories voted by users:

Information

Protein name	PHD finger-like domain-containing protein 5A
Main knot	3₁ (81%)
Global pLDDT	88.79
Species	Human
UniProt	Q7RTV0
Structure Prediction Model	AlphaFold v4: Q7RTV0
PDB structures	5IFE D 5O9Z y 5SYB A/B 5Z56 6 5Z57 6 5Z58 6 5ZYA D 6AH0 6 6AHD 6 6EN4 D 6FF4 y 6FF7 y 6QX9 BP 6Y50 y 6Y5Q y 7ABG y 7ABH y 7ABI y 7DVQ 6 7B0I D 7B91 D 7B92 D 7B9C D 7EVN D 7EVO 6 7OMF D 7ONB D 7OPI D 7Q3L G 7Q4O G 7Q4P G
Structures in KnotProt	5IFE D, K -3.1: 1-110 5O9Z y, K -3.1: 1-110 5SYB A/B, K -3.1: 1-110 5Z56 6, K -3.1: 1-110 5Z57 6, K -3.1: 1-110 5ZYA D, K -3.1: 7-91 6AH0 6, -3.1: 1-110 6AHD 6, -3.1: 1-110 6EN4 D, S -3.1: 1-98 6FF4 y, S -3.1: 1-110 6QX9 BP, K -3.1: 1-104 6Y50 y, -3.1: 1-110 6Y5Q y, -3.1: 1-110 7ABG y, -3.1: 1-110 7ABH y, -3.1: 1-110 7ABI y, -3.1: 1-110 7DVQ 6, -3.1: 1-110
Model length	110
AlphaFold deposition date	2022-06-01
AlphaKnot deposition date	2023-01-27

Help

Knot types & Model sequence

					Knot pLDDT	Knot core range	Knot core length	Knot tails range	N-end length	C-end length	Main Knot
					93.4	21-70	50	1-20, 71-110	20	40

Model Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Comments

AF1-Knot

Categories voted by users:

Information

Protein name	PHD finger-like domain-containing protein 5A
Main knot	3₁ (75%)
Knot fingerprint	K 3₁
Global pLDDT	89.2
Species	Human
UniProt	Q7RTV0
Structure Prediction Model	AlphaFold v1: Q7RTV0
PDB structures	5IFE D 5O9Z y 5SYB A/B 5Z56 6 5Z57 6 5Z58 6 5ZYA D 6AH0 6 6AHD 6 6EN4 D 6FF4 y 6FF7 y 6QX9 BP 6Y50 y 6Y5Q y 7ABG y 7ABH y 7ABI y 7DVQ 6
Structures in KnotProt	5IFE D, K -3.1: 1-110 5O9Z y, K -3.1: 1-110 5SYB A/B, K -3.1: 1-110 5Z56 6, K -3.1: 1-110 5Z57 6, K -3.1: 1-110 5ZYA D, K -3.1: 7-91 6AH0 6, -3.1: 1-110 6AHD 6, -3.1: 1-110 6EN4 D, S -3.1: 1-98 6FF4 y, S -3.1: 1-110 6QX9 BP, K -3.1: 1-104 6Y50 y, -3.1: 1-110 6Y5Q y, -3.1: 1-110 7ABG y, -3.1: 1-110 7ABH y, -3.1: 1-110 7ABI y, -3.1: 1-110 7DVQ 6, -3.1: 1-110
Model length	110
AlphaFold deposition date	2021-07-01
AlphaKnot deposition date	2021-12-18

Knot map

Knot cutoff: 48%

Help Knotting data interpretation

Help

Knot types & Model sequence

					Knot pLDDT	Knot core range	Knot core length	Knot tails range	N-end length	C-end length	Main Knot
					93.6	21-68	48	1-20, 69-110	20	42

Model Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Comments

ESM1

Categories voted by users:

Information

Protein name	PHD finger-like domain-containing protein 5A
Main knot	0₁ (92%)
Species	Human
UniProt	Q7RTV0
Structure Prediction Model	ESM v1: esmfold_v1 - nov. 2022
PDB structures	5IFE D 5O9Z y 5SYB A/B 5Z56 6 5Z57 6 5Z58 6 5ZYA D 6AH0 6 6AHD 6 6EN4 D 6FF4 y 6FF7 y 6QX9 BP 6Y50 y 6Y5Q y 7ABG y 7ABH y 7ABI y 7DVQ 6 7B0I D 7B91 D 7B92 D 7B9C D 7EVN D 7EVO 6 7OMF D 7ONB D 7OPI D 7Q3L G 7Q4O G 7Q4P G
Structures in KnotProt	5IFE D, K -3.1: 1-110 5O9Z y, K -3.1: 1-110 5SYB A/B, K -3.1: 1-110 5Z56 6, K -3.1: 1-110 5Z57 6, K -3.1: 1-110 5ZYA D, K -3.1: 7-91 6AH0 6, -3.1: 1-110 6AHD 6, -3.1: 1-110 6EN4 D, S -3.1: 1-98 6FF4 y, S -3.1: 1-110 6QX9 BP, K -3.1: 1-104 6Y50 y, -3.1: 1-110 6Y5Q y, -3.1: 1-110 7ABG y, -3.1: 1-110 7ABH y, -3.1: 1-110 7ABI y, -3.1: 1-110 7DVQ 6, -3.1: 1-110
Model length	110
ESM generation time	2023-06-24: download the generated 3D model
AlphaKnot deposition date	2023-06-28

Help

Model Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Comments

Domain	Eukaryota
Family	Hominidae
Species (Full Name)	Homo sapiens
PFAM codes	PF03660
InterPro codes	IPR005345
PDB structures (whole Protein)	5IFE D: 1-110 5O9Z y: 1-110 5SYB A/B: 1-110 5Z56 6: 1-110 5Z57 6: 1-110 5Z58 6: 1-110 5ZYA D: 7-91 6AH0 6: 1-110 6AHD 6: 1-110 6EN4 D: 1-98 6FF4 y: 1-110 6FF7 y: 1-110 6QX9 BP: 1-104 6Y50 y: 1-110 6Y5Q y: 1-110 7ABG y: 1-110 7ABH y: 1-110 7ABI y: 1-110 7DVQ 6: 1-110 7B0I D: 1-98 7B91 D: 1-98 7B92 D: 1-98 7B9C D: 1-98 7EVN D: 1-110 7EVO 6: 1-110 7OMF D: 1-98 7ONB D: 1-110 7OPI D: 1-98 7Q3L G: 1-110 7Q4O G: 1-110 7Q4P G: 1-110 7QTT D: 1-110 7VPX 6: 1-110 8CH6 D: 1-110 8H6E 2L: 1-110 8H6J 2L: 1-110 8H6K 2L: 1-110 8H6L 2L: 1-110 8HK1 6: 1-110 8I0P 7: 1-110 8I0R 7: 1-110 8I0S 7: 1-110 8I0T 7: 1-110 8I0U 7: 1-110 8I0V 7: 1-110 8QO9 BP: 1-110 8QXD BP: 1-110 8QZS BP: 1-110 8R08 BP: 1-110 8R09 BP: 1-110 8R0A BP: 1-110 8R0B BP: 1-110 8RM5 BP: 1-110 8Y7E 6: 1-110 9K1O D: 1-110 9K1Q D: 1-110 9K1R D: 1-110 9K1W D: 1-110 9K1Y D: 1-110

...loading similar chains, please wait...
similar chains with experimentally solved models (PDB) in the AlphaKnot 2.0 database (?% sequence similarity)

...loading similar chains, please wait...
similar chains with experimentally solved models not found in AlphaKnot 2.0 database but found in thePDB database (?% sequence similarity)

#similar chains with experimentally solved models (PDB) in the AlphaKnot 2.0 database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
        #similar chains with experimentally solved models not found in AlphaKnot 2.0 database but found in the pdb database (?% sequence similarity)
        ...loading similar chains, please wait...

Q7RTV0F1

AF4

Model Sequence

AF1-Knot

Model Sequence

ESM1

Model Sequence