| Protein name |
Carbonic anhydrase 13
|
| Main knot |
31 (51%)
|
| Global pLDDT |
96.82
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
 Q8N1Q1
|
| PDB structures | |
| Structures in KnotProt |
 3CZV A/B, K +3.1: 1-262 3D0N A/B, S +3.1: 1-262 3DA2 A/B, S +3.1: 1-261 4HU1 A/B, S +3.1: 1-262 4KNM A/B, S +3.1: 1-262 4KNN A/B, K +3.1: 1-262 4QIZ A/B, S +3.1: 1-262 4QJP A/B, S +3.1: 1-262 4QJX A, S +3.1: 1-262 4QSJ A/B, S +3.1: 1-262 5E2N A/B, S +3.1: 1-262 5LLA A/B, S +3.1: 1-262 5LLN A/B, K +3.1: 1-262 5OGJ A/B, S +3.1: 1-262 5OHH A/B, S +3.1: 1-262 6G5U A/B, S +3.1: 1-262
|
| Model length |
262
|
| AlphaFold deposition date |
2022-06-01
|
| AlphaKnot deposition date |
2023-01-27
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
 |
97.9 | 30-259 | 230 | 1-29, 260-262 | 29 | 3 |
|
Model Sequence |
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
| Protein name |
Carbonic anhydrase 13
|
| Main knot |
31 (54%)
|
| Knot fingerprint |
K 31
|
| Global pLDDT |
96.8
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v1:
Q8N1Q1
|
| PDB structures | |
| Structures in KnotProt |
3CZV A/B, K +3.1: 1-262 3D0N A/B, S +3.1: 1-262 3DA2 A/B, S +3.1: 1-261 4HU1 A/B, S +3.1: 1-262 4KNM A/B, S +3.1: 1-262 4KNN A/B, K +3.1: 1-262 4QIZ A/B, S +3.1: 1-262 4QJP A/B, S +3.1: 1-262 4QJX A, S +3.1: 1-262 4QSJ A/B, S +3.1: 1-262 5E2N A/B, S +3.1: 1-262 5LLA A/B, S +3.1: 1-262 5LLN A/B, K +3.1: 1-262 5OGJ A/B, S +3.1: 1-262 5OHH A/B, S +3.1: 1-262 6G5U A/B, S +3.1: 1-262
|
| Model length |
262
|
| AlphaFold deposition date |
2021-07-01
|
| AlphaKnot deposition date |
2021-12-18
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
97.9 | 27-258 | 232 | 1-26, 259-262 | 26 | 4 |
|
Model Sequence |
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
| Protein name |
Carbonic anhydrase 13
|
| Main knot |
31 (54%)
|
| Global pLDDT |
88.64
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
ESM v1: esmfold_v1 - nov. 2022
|
| PDB structures | |
| Structures in KnotProt |
3CZV A/B, K +3.1: 1-262 3D0N A/B, S +3.1: 1-262 3DA2 A/B, S +3.1: 1-261 4HU1 A/B, S +3.1: 1-262 4KNM A/B, S +3.1: 1-262 4KNN A/B, K +3.1: 1-262 4QIZ A/B, S +3.1: 1-262 4QJP A/B, S +3.1: 1-262 4QJX A, S +3.1: 1-262 4QSJ A/B, S +3.1: 1-262 5E2N A/B, S +3.1: 1-262 5LLA A/B, S +3.1: 1-262 5LLN A/B, K +3.1: 1-262 5OGJ A/B, S +3.1: 1-262 5OHH A/B, S +3.1: 1-262 6G5U A/B, S +3.1: 1-262
|
| Model length |
262
|
| ESM generation time |
2023-06-23: download the generated 3D model
|
| AlphaKnot deposition date |
2023-06-28
|
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Main Knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
83.7 | 30-259 | 230 | 1-29, 260-262 | 29 | 3 |
|
Model Sequence |
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
| Domain |
Eukaryota
|
| Family |
Hominidae
|
| Species (Full Name) |
Homo sapiens
|
| PFAM codes |
PF00194
|
| InterPro codes |
 IPR001148, IPR018338, IPR023561, IPR036398
|
| PDB structures (whole Protein) |
 3CZV A/B: 1-262 3D0N A/B: 1-262 3DA2 A/B: 1-261 4HU1 A/B: 1-262 4KNM A/B: 1-262 4KNN A/B: 1-262 4QIZ A/B: 1-262 4QJP A/B: 1-262 4QJX A: 1-262 4QSJ A/B: 1-262 5E2N A/B: 1-262 5LLA A/B: 1-262 5LLN A/B: 1-262 5OGJ A/B: 1-262 5OHH A/B: 1-262 6G5U A/B: 1-262
|
#similar chains with experimentally solved models (PDB) in the AlphaKnot 2.0 database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains with experimentally solved models not found in AlphaKnot 2.0 database but found in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
Q8N1Q1