| Status | Status Details | Main knot | Main knot (knot pull) | Project name | Input data | Model lengths | Last status changed | Job submitted | Key | What to compute? | Closure | Number of random closures | Accuracy | Trajectory (Knot Pull) | Search Identical |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FINISHED | 2024-11-14 13:46:33: AF-A0A1I0QM73-F1 - main chain unknotted ... | 61 (50%) | 80(A)[8(+), 14(-), 12(-), 2(+), 16(+), 6(-), 4(-), 10(+)](A) | Recomputed from: Delta A0A1I0QM73-F1-AFv4 |
AF-A0A1I0QM73-F1.cif |
2024-11-14 14:12:34 | 2024-11-14 13:45:31 | 35bb2c00511668 | Full matrix always | close by statistical methods | 20 | Quick | Yes | Yes: Identity: 70% |
| Main knot |
61 (50%)
|
| Knot fingerprint |
K 83(x2) 61(x2) 41(x5)
|
| Global pLDDT |
91.6
|
| Topological complexity |
Knot with a low (6) number of crossings
|
| pLDDT Knot-core |
Very high (92.1); 97.8% has >70 pLDDT; 0.0% has <50 pLDDT
|
| pLDDT N-end knot-core border |
Very high (93.6); 100.0% has >70 pLDDT; 0.0% has <50 pLDDT
|
| pLDDT C-end knot-core border |
Very high (92.0); 100.0% has >70 pLDDT; 0.0% has <50 pLDDT
|
| C-alpha clashes |
No clashes
|
Knot cutoff: 30 %
| Knot pLDDT | Knot core range | Knot core length | Knot tails range | N-end length | C-end length | Slipknot tails | Slipknot loops | Main knot | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
None | 9-466 | 457 | 1-8, 467-474 | 8 | 8 |
|
Knot | |||||
|
92.2 | 109-463 | 354 | 1-108, 464-474 | 108 | 11 | 1-86 | 87-108 | Slipknot | ||||
|
91.8 | 115-412 | 297 | 1-114, 413-474 | 114 | 62 | 1-27,461-474 | 28-114,413-460 | Slipknot |
Model Sequence |
MKDLSYVASEITKEKNLEMNLPKFANSMMSLYNGLAYVKLSMNYYTYYDMLSDKEYENTDLAKIKAFLERLNTIIEKEVINEGSVETLEESIIETDNIRNEIIKIMEVVTSYVDRLKIYEYILNRVEFKFSKEEFDEEYYMNDLTNDLMHYILADKDSMVTNGKIAEIIGQLPIRLSKNKFFDYISGSFSLYRGAQKGTIDDFVYALRTTAMLDQPEGFESGFQDVNNIYNDLKNADYKNLTQEEYKALADKLLIATQTMSNTSDLFVILIQLVNDVYTIILSKMYAFNNVDEINKSKYVIKSTLEGFNGNEYDSDDEKIIDCFTGFEGKQEKIITVTIANEYVIDYVLKNQSVTLQSIMLEKAYNALSIIFKLQSGSDFIALYDSTDKQEIASNDYVDIAFNSLIAELETLFKDSSQIINRAVMSTVLSQLPVFFNNIDEIQRYINSSLIQCSDKAEKMACVEVMNLLMNGDN
|
