P0A873F1

tRNA (guanine-N(1)-)-methyltransferase
Knot
Information
Protein name
tRNA (guanine-N(1)-)-methyltransferase
Main knot
31 (89%)
Knot fingerprint
K 31
Global pLDDT
95.23
Organism
Escherichia coli
UniProt
AlphaFold
PDB structures
Structures in KnotProt
Model length
255
Knot map

Knot cutoff: 48%


Help
Knot types & Model sequence
Knot pLDDT Knot core range Knot core length Knot tails range N-end length C-end length Main Knot
97.6 86-129 43 1-85, 130-255 85 126
Model Sequence
MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEFKTEHAQQQHKHDGMA
Gene trmD
Citation title Highly accurate protein structure prediction with AlphaFold
sequence length 255
structure length 255
PDB structures (whole Protein)  1P9P A: 1-255
AlphaFold deposition date 2021-07-01
AlphaKnot deposition date 2021-12-18
...loading similar chains, please wait...
similar chains in the AlphaKnot database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the PDB database (?% sequence similarity)

 
#similar chains in the Alphaknot database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...